PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G01930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 376aa    MW: 40597.1 Da    PI: 5.6987
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G01930.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.29.9e-10229286562
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      kr +r   NR +A rs +RK  +i+eLe+kv+ L++e + L  +l +++  +a l ++
  OPUNC03G01930.1 229 KRVKRVLANRQSAARSKERKMRYIAELEQKVQILQSEATNLSTQLTMMQRDSAGLATQ 286
                      999***************************************9999988887777666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.4E-16225289IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.611227290IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.2E-10229286No hitNo description
PfamPF001701.0E-8229287IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.5E-11229280No hitNo description
CDDcd147031.14E-21230281No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MNGGIGDALM QPQHVQVMSS SLPMVASTFG GGGLPPRKAH RRSSSDVPFG YLGGQHQLPP  60
PKVEAGWGHL GGGGAATTDD LFNAYLNLEG LDGLNSSDDR HDEGDSRGSS IKTNGADSSE  120
NESEECADDT RAGIRLWSAD GAERREGVKR NATGEPAPAP LARHARSLSM DSLIGKFNFT  180
AAAAVAGNGV GLGPNRFSLE FGSGEFTPSE MKKIMADEKL AEMALADPKR VKRVLANRQS  240
AARSKERKMR YIAELEQKVQ ILQSEATNLS TQLTMMQRDS AGLATQNNEL KFRLHAMEQQ  300
AQLRDALNEA LTTEVQRLKL ATAELGDSCS SSSLAQQIQL NAQNQMFQLQ QQQATQIPFY  360
QLQQSQQNGA DNEPKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2365410.0AC236541.1 Oryza minuta clone OM__Ba0161K15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627932.10.0PREDICTED: transcription factor RF2b-like
TrEMBLA0A0E0K8810.0A0A0E0K881_ORYPU; Uncharacterized protein
STRINGLOC_Os03g03550.10.0(Oryza sativa Japonica Group)
STRINGORGLA03G0019600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.33e-85bZIP family protein